Lineage for d1nccl2 (1ncc L:109-214)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2025133Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2028190Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)
  7. 2028422Species Mouse (Mus musculus) [TaxId:10090] [88567] (358 PDB entries)
    Uniprot P01837# KAC_MOUSE Ig kappa chain C region; 99% sequence identity ! SQ NA # natural chimera; best hits are: Uniprot P01637 (Ig kappa chain V-V region T1) and Uniprot P01837 (Ig kappa chain C region) ! Uniprot P01837 # KAC_MOUSE Ig kappa chain C region ! Uniprot P01837 # KAC_MOUSE (P01837) Ig kappa chain C region ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01837 # ! KAC_MOUSE Ig kappa chain C region
  8. 2028680Domain d1nccl2: 1ncc L:109-214 [21042]
    Other proteins in same PDB: d1ncch1, d1ncch2, d1nccl1, d1nccn_
    part of Fab NC41
    complexed with ca, nag; mutant

Details for d1nccl2

PDB Entry: 1ncc (more details), 2.5 Å

PDB Description: crystal structures of two mutant neuraminidase-antibody complexes with amino acid substitutions in the interface
PDB Compounds: (L:) igg2a-kappa nc41 fab (light chain)

SCOPe Domain Sequences for d1nccl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nccl2 b.1.1.2 (L:109-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds
kdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOPe Domain Coordinates for d1nccl2:

Click to download the PDB-style file with coordinates for d1nccl2.
(The format of our PDB-style files is described here.)

Timeline for d1nccl2: