Lineage for d1nccl2 (1ncc L:109-214)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 8163Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 8462Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)
  7. 9066Species Fab NC41 (mouse), kappa L chain [49010] (4 PDB entries)
  8. 9072Domain d1nccl2: 1ncc L:109-214 [21042]
    Other proteins in same PDB: d1ncch1, d1nccl1, d1nccn_

Details for d1nccl2

PDB Entry: 1ncc (more details), 2.5 Å

PDB Description: crystal structures of two mutant neuraminidase-antibody complexes with amino acid substitutions in the interface

SCOP Domain Sequences for d1nccl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nccl2 b.1.1.2 (L:109-214) Immunoglobulin (constant domains of L and H chains) {Fab NC41 (mouse), kappa L chain}
adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds
kdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOP Domain Coordinates for d1nccl2:

Click to download the PDB-style file with coordinates for d1nccl2.
(The format of our PDB-style files is described here.)

Timeline for d1nccl2: