SCOPe 2.08: Domain d3g6al1: 3g6a L:1-108

Lineage for d3g6al1 (3g6a L:1-108)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d3g6al1: 3g6a L:1-108 [210417]
   Other proteins in same PDB: d3g6aa2, d3g6ab1, d3g6ab2, d3g6ah1, d3g6ah2, d3g6al2
   automated match to d1adql1

Details for d3g6al1

PDB Entry: 3g6a, 2.1 Å

PDB Description: Crystal structure of anti-IL-13 antibody CNTO607

PDB Compounds: (L:) CNTO607 Fab Light chain

SCOPe Domain Sequences for d3g6al1:

Sequence; same for both SEQRES and ATOM records:

>d3g6al1 b.1.1.0 (L:1-108) automated matches {Human (Homo sapiens) [TaxId: 9606]}
syeltqppsvsvapgqtariscsgdniggtfvswyqqkpgqapvlviyddndrpsgiper
fsgsnsgntatltisgtqaedeadyycgtwdmvtnnvfgggtkltvlg

Timeline for d3g6al1:

• d3g6al1 first appeared in SCOPe 2.03
  
• d3g6al1 appears in SCOPe 2.07