Lineage for d3g6aa2 (3g6a A:109-210)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2352435Protein automated matches [190374] (14 species)
    not a true protein
  7. 2352460Species Human (Homo sapiens) [TaxId:9606] [187221] (765 PDB entries)
  8. 2352647Domain d3g6aa2: 3g6a A:109-210 [210416]
    Other proteins in same PDB: d3g6aa1, d3g6ab1, d3g6ab2, d3g6ah1, d3g6ah2, d3g6al1
    automated match to d1adql2

Details for d3g6aa2

PDB Entry: 3g6a (more details), 2.1 Å

PDB Description: Crystal structure of anti-IL-13 antibody CNTO607
PDB Compounds: (A:) CNTO607 Fab Light chain

SCOPe Domain Sequences for d3g6aa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3g6aa2 b.1.1.2 (A:109-210) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvapt

SCOPe Domain Coordinates for d3g6aa2:

Click to download the PDB-style file with coordinates for d3g6aa2.
(The format of our PDB-style files is described here.)

Timeline for d3g6aa2: