SCOPe 2.08: Domain d3g6aa2: 3g6a A:109-210

Lineage for d3g6aa2 (3g6a A:109-210)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d3g6aa2: 3g6a A:109-210 [210416]
   Other proteins in same PDB: d3g6aa1, d3g6ab1, d3g6ab2, d3g6ah1, d3g6ah2, d3g6al1
   automated match to d1adql2

Details for d3g6aa2

PDB Entry: 3g6a, 2.1 Å

PDB Description: Crystal structure of anti-IL-13 antibody CNTO607

PDB Compounds: (A:) CNTO607 Fab Light chain

SCOPe Domain Sequences for d3g6aa2:

Sequence; same for both SEQRES and ATOM records:

>d3g6aa2 b.1.1.2 (A:109-210) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvapt

Timeline for d3g6aa2:

• d3g6aa2 first appeared in SCOPe 2.03
  
• d3g6aa2 appears in SCOPe 2.07