Lineage for d3g5za2 (3g5z A:111-213)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1290587Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1294263Protein automated matches [190374] (12 species)
    not a true protein
  7. 1294862Species Mouse (Mus musculus) [TaxId:10090] [224855] (237 PDB entries)
  8. 1295178Domain d3g5za2: 3g5z A:111-213 [210414]
    Other proteins in same PDB: d3g5za1
    automated match to d2fbjl2

Details for d3g5za2

PDB Entry: 3g5z (more details), 2.6 Å

PDB Description: Antibodies Specifically Targeting a Locally Misfolded Region of Tumor Associated EGFR
PDB Compounds: (A:) 175 light chain

SCOPe Domain Sequences for d3g5za2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3g5za2 b.1.1.2 (A:111-213) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
aaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskd
stysmsstltltkdeyerhnsytceathktstspivksfnrne

SCOPe Domain Coordinates for d3g5za2:

Click to download the PDB-style file with coordinates for d3g5za2.
(The format of our PDB-style files is described here.)

Timeline for d3g5za2: