SCOPe 2.08: Domain d3g5xc2: 3g5x C:108-214

Lineage for d3g5xc2 (3g5x C:108-214)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)

8. Domain d3g5xc2: 3g5x C:108-214 [210412]
   Other proteins in same PDB: d3g5xa1, d3g5xb_, d3g5xc1, d3g5xd_
   automated match to d1c12a2

Details for d3g5xc2

PDB Entry: 3g5x, 2.3 Å

PDB Description: Antibodies Specifically Targeting a Locally Misfolded Region of Tumor Associated EGFR

PDB Compounds: (C:) 806 light chain

SCOPe Domain Sequences for d3g5xc2:

Sequence; same for both SEQRES and ATOM records:

>d3g5xc2 b.1.1.2 (C:108-214) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

Timeline for d3g5xc2:

• d3g5xc2 first appeared in SCOPe 2.03
  
• d3g5xc2 appears in SCOPe 2.07