Lineage for d3g5xc2 (3g5x C:108-214)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2752318Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)
  8. 2752647Domain d3g5xc2: 3g5x C:108-214 [210412]
    Other proteins in same PDB: d3g5xa1, d3g5xb_, d3g5xc1, d3g5xd_
    automated match to d1c12a2

Details for d3g5xc2

PDB Entry: 3g5x (more details), 2.3 Å

PDB Description: Antibodies Specifically Targeting a Locally Misfolded Region of Tumor Associated EGFR
PDB Compounds: (C:) 806 light chain

SCOPe Domain Sequences for d3g5xc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3g5xc2 b.1.1.2 (C:108-214) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOPe Domain Coordinates for d3g5xc2:

Click to download the PDB-style file with coordinates for d3g5xc2.
(The format of our PDB-style files is described here.)

Timeline for d3g5xc2: