Class b: All beta proteins [48724] (149 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species) |
Species Mouse (Mus musculus) [TaxId:10090] [88576] (302 PDB entries) |
Domain d1ncdh2: 1ncd H:114-227 [21041] Other proteins in same PDB: d1ncdh1, d1ncdl1, d1ncdl2, d1ncdn_ part of Fab NC41 complexed with ca, man, nag |
PDB Entry: 1ncd (more details), 2.9 Å
SCOP Domain Sequences for d1ncdh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ncdh2 b.1.1.2 (H:114-227) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)} akttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd lytlsssvtvtsstwpsqsitcnvahpasstkvdkkieprg
Timeline for d1ncdh2: