SCOPe 2.03: Domain d3g5kd_: 3g5k D:

Lineage for d3g5kd_ (3g5k D:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.167: Peptide deformylase [56419] (1 superfamily)
   alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix

4. Superfamily d.167.1: Peptide deformylase [56420] (2 families)
   nickel-dependent enzyme

5. Family d.167.1.0: automated matches [191587] (1 protein)
   not a true family

6. Protein automated matches [191055] (9 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225635] (2 PDB entries)

8. Domain d3g5kd_: 3g5k D: [210400]
   automated match to d1vezb_
   complexed with bb2, co

Details for d3g5kd_

PDB Entry: 3g5k, 1.7 Å

PDB Description: Structure and activity of human mitochondrial peptide deformylase, a novel cancer target

PDB Compounds: (D:) Peptide deformylase, mitochondrial

SCOPe Domain Sequences for d3g5kd_:

Sequence; same for both SEQRES and ATOM records:

>d3g5kd_ d.167.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hmsfshvcqvgdpvlrgvaapveraqlggpelqrltqrlvqvmrrrrcvglsapqlgvpr
qvlalelpealcrecpprqralrqmepfplrvfvnpslrvldsrlvtfpegcesvagfla
cvprfqavqisgldpngeqvvwqasgwaariiqhemdhlqgclfidkmdsrtftnvywmk
vnd

Timeline for d3g5kd_:

• d3g5kd_ is new in SCOPe 2.03-stable
  
• d3g5kd_ appears in SCOPe 2.04
  
• d3g5kd_ appears in the current release, SCOPe 2.08, called d3g5kd1