Lineage for d3g5ka_ (3g5k A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1940264Fold d.167: Peptide deformylase [56419] (1 superfamily)
    alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix
  4. 1940265Superfamily d.167.1: Peptide deformylase [56420] (2 families) (S)
    nickel-dependent enzyme
  5. 1940418Family d.167.1.0: automated matches [191587] (1 protein)
    not a true family
  6. 1940419Protein automated matches [191055] (11 species)
    not a true protein
  7. 1940436Species Human (Homo sapiens) [TaxId:9606] [225635] (2 PDB entries)
  8. 1940437Domain d3g5ka_: 3g5k A: [210397]
    automated match to d1vezb_
    complexed with bb2, co

Details for d3g5ka_

PDB Entry: 3g5k (more details), 1.7 Å

PDB Description: Structure and activity of human mitochondrial peptide deformylase, a novel cancer target
PDB Compounds: (A:) Peptide deformylase, mitochondrial

SCOPe Domain Sequences for d3g5ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3g5ka_ d.167.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hmsfshvcqvgdpvlrgvaapveraqlggpelqrltqrlvqvmrrrrcvglsapqlgvpr
qvlalelpealcrecpprqralrqmepfplrvfvnpslrvldsrlvtfpegcesvagfla
cvprfqavqisgldpngeqvvwqasgwaariiqhemdhlqgclfidkmdsrtftnvywmk
vnd

SCOPe Domain Coordinates for d3g5ka_:

Click to download the PDB-style file with coordinates for d3g5ka_.
(The format of our PDB-style files is described here.)

Timeline for d3g5ka_: