![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.167: Peptide deformylase [56419] (1 superfamily) alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix |
![]() | Superfamily d.167.1: Peptide deformylase [56420] (2 families) ![]() nickel-dependent enzyme |
![]() | Family d.167.1.0: automated matches [191587] (1 protein) not a true family |
![]() | Protein automated matches [191055] (11 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [225635] (2 PDB entries) |
![]() | Domain d3g5ka_: 3g5k A: [210397] automated match to d1vezb_ complexed with bb2, co |
PDB Entry: 3g5k (more details), 1.7 Å
SCOPe Domain Sequences for d3g5ka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3g5ka_ d.167.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} hmsfshvcqvgdpvlrgvaapveraqlggpelqrltqrlvqvmrrrrcvglsapqlgvpr qvlalelpealcrecpprqralrqmepfplrvfvnpslrvldsrlvtfpegcesvagfla cvprfqavqisgldpngeqvvwqasgwaariiqhemdhlqgclfidkmdsrtftnvywmk vnd
Timeline for d3g5ka_: