Lineage for d3g5gj_ (3g5g J:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2709316Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 2709317Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 2709766Family a.35.1.0: automated matches [191534] (1 protein)
    not a true family
  6. 2709767Protein automated matches [190907] (21 species)
    not a true protein
  7. 2709779Species Enterobacter sp. [TaxId:211595] [189872] (13 PDB entries)
  8. 2709815Domain d3g5gj_: 3g5g J: [210392]
    automated match to d4f8da_

Details for d3g5gj_

PDB Entry: 3g5g (more details), 2.8 Å

PDB Description: Crystal Structure of the Wild-Type Restriction-Modification Controller Protein C.Esp1396I
PDB Compounds: (J:) Regulatory protein

SCOPe Domain Sequences for d3g5gj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3g5gj_ a.35.1.0 (J:) automated matches {Enterobacter sp. [TaxId: 211595]}
esfllskvsfvikkirlekgmtqedlayksnldrtyisgiernsrnltikslelimkgle
vsdvvffemlikeilkhd

SCOPe Domain Coordinates for d3g5gj_:

Click to download the PDB-style file with coordinates for d3g5gj_.
(The format of our PDB-style files is described here.)

Timeline for d3g5gj_: