| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily) core: 4 helices; folded leaf, closed |
Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) ![]() |
| Family a.35.1.0: automated matches [191534] (1 protein) not a true family |
| Protein automated matches [190907] (3 species) not a true protein |
| Species Enterobacter sp. [TaxId:211595] [189872] (11 PDB entries) |
| Domain d3g5gf_: 3g5g F: [210388] automated match to d4f8da_ |
PDB Entry: 3g5g (more details), 2.8 Å
SCOPe Domain Sequences for d3g5gf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3g5gf_ a.35.1.0 (F:) automated matches {Enterobacter sp. [TaxId: 211595]}
esfllskvsfvikkirlekgmtqedlayksnldrtyisgiernsrnltikslelimkgle
vsdvvffemlikeilkh
Timeline for d3g5gf_: