Class a: All alpha proteins [46456] (286 folds) |
Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily) multihelical; consists of two different alpha-helical bundles |
Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) |
Family a.211.1.2: PDEase [48548] (7 proteins) Pfam PF00233; multihelical; can be divided into three subdomains |
Protein Catalytic domain of cyclic nucleotide phosphodiesterase pde4d [89151] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [89152] (35 PDB entries) Uniprot Q08499 388-713 |
Domain d3g58a_: 3g58 A: [210377] automated match to d1f0ja_ complexed with 988, edo, mg, so4, zn |
PDB Entry: 3g58 (more details), 2.05 Å
SCOPe Domain Sequences for d3g58a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3g58a_ a.211.1.2 (A:) Catalytic domain of cyclic nucleotide phosphodiesterase pde4d {Human (Homo sapiens) [TaxId: 9606]} siprfgvkteqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfki pvdtlitylmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifas aihdvdhpgvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqr qslrkmvidivlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhca dlsnptkplqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyiv hplwetwadlvhpdaqdildtlednrewyqstipq
Timeline for d3g58a_: