SCOPe 2.03: Domain d3g4pa_: 3g4p A:

Lineage for d3g4pa_ (3g4p A:)

1. Root: SCOPe 2.03

2. Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.0: automated matches [191512] (1 protein)
   not a true family

6. Protein automated matches [190857] (15 species)
   not a true protein

7. Species Acinetobacter baumannii [TaxId:470] [194613] (18 PDB entries)

8. Domain d3g4pa_: 3g4p A: [210375]
   automated match to d1k38a_

Details for d3g4pa_

PDB Entry: 3g4p, 1.97 Å

PDB Description: OXA-24 beta-lactamase at pH 7.5

PDB Compounds: (A:) beta-lactamase oxa-24

SCOPe Domain Sequences for d3g4pa_:

Sequence; same for both SEQRES and ATOM records:

>d3g4pa_ e.3.1.0 (A:) automated matches {Acinetobacter baumannii [TaxId: 470]}
hissqqhekaiksyfdeaqtqgviiikegknlstygnalarankeyvpastfkmlnalig
lenhkattneifkwdgkkrtypmwekdmtlgeamalsavpvyqelarrtglelmqkevkr
vnfgntnigtqvdnfwlvgplkitpvqevnfaddlahnrlpfkletqeevkkmllikevn
gskiyaksgwgmgvtpqvgwltgwveqangkkipfslnlemkegmsgsirneitykslen
lgii

Timeline for d3g4pa_:

• d3g4pa_ is new in SCOPe 2.03-stable
  
• d3g4pa_ appears in SCOPe 2.04
  
• d3g4pa_ appears in the current release, SCOPe 2.08