Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds) |
Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) |
Family e.3.1.0: automated matches [191512] (1 protein) not a true family |
Protein automated matches [190857] (15 species) not a true protein |
Species Acinetobacter baumannii [TaxId:470] [194613] (18 PDB entries) |
Domain d3g4pa_: 3g4p A: [210375] automated match to d1k38a_ |
PDB Entry: 3g4p (more details), 1.97 Å
SCOPe Domain Sequences for d3g4pa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3g4pa_ e.3.1.0 (A:) automated matches {Acinetobacter baumannii [TaxId: 470]} hissqqhekaiksyfdeaqtqgviiikegknlstygnalarankeyvpastfkmlnalig lenhkattneifkwdgkkrtypmwekdmtlgeamalsavpvyqelarrtglelmqkevkr vnfgntnigtqvdnfwlvgplkitpvqevnfaddlahnrlpfkletqeevkkmllikevn gskiyaksgwgmgvtpqvgwltgwveqangkkipfslnlemkegmsgsirneitykslen lgii
Timeline for d3g4pa_: