SCOPe 2.08: Domain d3g4oa1: 3g4o A:2-84

Lineage for d3g4oa1 (3g4o A:2-84)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.2: Aerolysin/Pertussis toxin (APT) domain [56467] (3 proteins)
   automatically mapped to Pfam PF03440

6. Protein Proaerolysin, N-terminal domain [56470] (1 species)

7. Species Aeromonas hydrophila [TaxId:644] [56471] (6 PDB entries)

8. Domain d3g4oa1: 3g4o A:2-84 [210371]
   Other proteins in same PDB: d3g4oa2, d3g4ob2
   automated match to d1z52a1
   mutant

Details for d3g4oa1

PDB Entry: 3g4o, 2.3 Å

PDB Description: crystal structure of the activated aerolysin mutant h132n

PDB Compounds: (A:) Aerolysin

SCOPe Domain Sequences for d3g4oa1:

Sequence; same for both SEQRES and ATOM records:

>d3g4oa1 d.169.1.2 (A:2-84) Proaerolysin, N-terminal domain {Aeromonas hydrophila [TaxId: 644]}
epvypdqlrlfslgqgvcgdkyrpvnreeaqsvksnivgmmgqwqisglangwvimgpgy
ngeikpgtasntwcyptnpvtge

Timeline for d3g4oa1:

• d3g4oa1 first appeared in SCOPe 2.03
  
• d3g4oa1 appears in SCOPe 2.07