Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) |
Family d.169.1.2: Aerolysin/Pertussis toxin (APT) domain [56467] (3 proteins) automatically mapped to Pfam PF03440 |
Protein Proaerolysin, N-terminal domain [56470] (1 species) |
Species Aeromonas hydrophila [TaxId:644] [56471] (6 PDB entries) |
Domain d3g4nb1: 3g4n B:2-84 [210369] Other proteins in same PDB: d3g4na2, d3g4nb2 automated match to d1z52a1 mutant |
PDB Entry: 3g4n (more details), 2.1 Å
SCOPe Domain Sequences for d3g4nb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3g4nb1 d.169.1.2 (B:2-84) Proaerolysin, N-terminal domain {Aeromonas hydrophila [TaxId: 644]} epvypdqlrlfslgqgvcgdkyrpvnreeaqsvksnivgmmgqwqisglangwvimgpgy ngeikpgtasntwcyptnpvtge
Timeline for d3g4nb1: