Lineage for d3g4fa2 (3g4f A:227-554)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2010547Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 2010548Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 2010904Family a.128.1.0: automated matches [196408] (1 protein)
    not a true family
  6. 2010905Protein automated matches [196409] (36 species)
    not a true protein
  7. 2010926Species Gossypium arboreum [TaxId:29729] [225679] (2 PDB entries)
  8. 2010929Domain d3g4fa2: 3g4f A:227-554 [210356]
    Other proteins in same PDB: d3g4fa1, d3g4fb1
    automated match to d1hxga2
    complexed with bme, fpf, mg

Details for d3g4fa2

PDB Entry: 3g4f (more details), 2.65 Å

PDB Description: Crystal Structure of (+)- -Cadinene Synthase from Gossypium arboreum in complex with 2-fluorofarnesyl diphosphate
PDB Compounds: (A:) (+)-delta-cadinene synthase isozyme XC1

SCOPe Domain Sequences for d3g4fa2:

Sequence, based on SEQRES records: (download)

>d3g4fa2 a.128.1.0 (A:227-554) automated matches {Gossypium arboreum [TaxId: 29729]}
hnkallefakidfnmlqflhrkelseicrwwkdldfqrklpyardrvvegyfwisgvyfe
pqyslgrkmltkviamasivddtydsyatyeelipytnaierwdikcideipeymkpsyk
alldvyeemvqlvaehgrqyrveyaknamirlaqsylveakwtlqnykpsfeefkanalp
tcgyamlaitsfvgmgdivtpetfkwaasdpkiiqastiicrfmddvaehkfkhrreddc
saiecymeeygvtaqeaydvfnkhvesawkdlnqeflkptemptevlnrslnlarvmdvl
yregdgytyvgkaakggitslliepial

Sequence, based on observed residues (ATOM records): (download)

>d3g4fa2 a.128.1.0 (A:227-554) automated matches {Gossypium arboreum [TaxId: 29729]}
hnkallefakidfnmlqflhrkelseicrwwkdldfqrklpyardrvvegyfwisgvyfe
pqyslgrkmltkviamasivddtydsyatyeelipytnaierwdikcideipeymkpsyk
alldvyeemvqlvaehgrqyrveyaknamirlaqsylveakwtlqnykpsfeefkanalp
tcgyamlaitsfvgmgdivtpetfkwaasdpkiiqastiicrfmddvaehkfdcsaiecy
meeygvtaqeaydvfnkhvesawkdlnqeflkptemptevlnrslnlarvmdvlyreyvg
kaakggitslliepial

SCOPe Domain Coordinates for d3g4fa2:

Click to download the PDB-style file with coordinates for d3g4fa2.
(The format of our PDB-style files is described here.)

Timeline for d3g4fa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3g4fa1