Lineage for d3g4db1 (3g4d B:28-226)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1742882Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 1743246Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) (S)
  5. 1743570Family a.102.4.0: automated matches [227201] (1 protein)
    not a true family
  6. 1743571Protein automated matches [226931] (7 species)
    not a true protein
  7. 1743575Species Gossypium arboreum [TaxId:29729] [225678] (2 PDB entries)
  8. 1743577Domain d3g4db1: 3g4d B:28-226 [210353]
    Other proteins in same PDB: d3g4da2, d3g4db2
    automated match to d1hxga1
    complexed with bme, gol

Details for d3g4db1

PDB Entry: 3g4d (more details), 2.4 Å

PDB Description: Crystal Structure of (+)-delta-Cadinene Synthase from Gossypium arboreum and Evolutionary Divergence of Metal Binding Motifs for Catalysis
PDB Compounds: (B:) (+)-delta-cadinene synthase isozyme XC1

SCOPe Domain Sequences for d3g4db1:

Sequence, based on SEQRES records: (download)

>d3g4db1 a.102.4.0 (B:28-226) automated matches {Gossypium arboreum [TaxId: 29729]}
qpsiwgdlflncpdknidaetekrhqqlkeevrkmivapmanstqklafidsvqrlgvsy
hftkeiedeleniyhnnndaendlyttsirfrllrehgynvscdvfnkfkdeqgnfkssv
tsdvrgllelyqasylrvhgedildeaisftthhlslavasldhplseevshalkqsirr
glprvearhylsvyqdies

Sequence, based on observed residues (ATOM records): (download)

>d3g4db1 a.102.4.0 (B:28-226) automated matches {Gossypium arboreum [TaxId: 29729]}
qpsiwgdlflncpdkniaetekrhqqlkeevrkmivapmanstqklafidsvqrlgvsyh
ftkeiedeleniyhnndlyttsirfrllrehgynvscdvfnkfkdeqgnfkssvtsdvrg
llelyqasylrvhgedildeaisftthhlslavasldhplseevshalkqsirrglprve
arhylsvyqdies

SCOPe Domain Coordinates for d3g4db1:

Click to download the PDB-style file with coordinates for d3g4db1.
(The format of our PDB-style files is described here.)

Timeline for d3g4db1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3g4db2