SCOPe 2.03: Domain d3g4db1: 3g4d B:28-226

Lineage for d3g4db1 (3g4d B:28-226)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
   multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies

4. Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families)

5. Family a.102.4.0: automated matches [227201] (1 protein)
   not a true family

6. Protein automated matches [226931] (6 species)
   not a true protein

7. Species Gossypium arboreum [TaxId:29729] [225678] (2 PDB entries)

8. Domain d3g4db1: 3g4d B:28-226 [210353]
   Other proteins in same PDB: d3g4da2, d3g4db2
   automated match to d1hxga1
   complexed with bme, gol

Details for d3g4db1

PDB Entry: 3g4d, 2.4 Å

PDB Description: Crystal Structure of (+)-delta-Cadinene Synthase from Gossypium arboreum and Evolutionary Divergence of Metal Binding Motifs for Catalysis

PDB Compounds: (B:) (+)-delta-cadinene synthase isozyme XC1

SCOPe Domain Sequences for d3g4db1:

Sequence, based on SEQRES records:

>d3g4db1 a.102.4.0 (B:28-226) automated matches {Gossypium arboreum [TaxId: 29729]}
qpsiwgdlflncpdknidaetekrhqqlkeevrkmivapmanstqklafidsvqrlgvsy
hftkeiedeleniyhnnndaendlyttsirfrllrehgynvscdvfnkfkdeqgnfkssv
tsdvrgllelyqasylrvhgedildeaisftthhlslavasldhplseevshalkqsirr
glprvearhylsvyqdies

Sequence, based on observed residues (ATOM records):

>d3g4db1 a.102.4.0 (B:28-226) automated matches {Gossypium arboreum [TaxId: 29729]}
qpsiwgdlflncpdkniaetekrhqqlkeevrkmivapmanstqklafidsvqrlgvsyh
ftkeiedeleniyhnndlyttsirfrllrehgynvscdvfnkfkdeqgnfkssvtsdvrg
llelyqasylrvhgedildeaisftthhlslavasldhplseevshalkqsirrglprve
arhylsvyqdies

Timeline for d3g4db1:

• d3g4db1 is new in SCOPe 2.03-stable
  
• d3g4db1 appears in SCOPe 2.04
  
• d3g4db1 appears in the current release, SCOPe 2.08