![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.128: Terpenoid synthases [48575] (1 superfamily) multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers |
![]() | Superfamily a.128.1: Terpenoid synthases [48576] (6 families) ![]() duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J |
![]() | Family a.128.1.0: automated matches [196408] (1 protein) not a true family |
![]() | Protein automated matches [196409] (21 species) not a true protein |
![]() | Species Gossypium arboreum [TaxId:29729] [225679] (2 PDB entries) |
![]() | Domain d3g4da2: 3g4d A:227-554 [210352] Other proteins in same PDB: d3g4da1, d3g4db1 automated match to d1hxga2 complexed with bme, gol |
PDB Entry: 3g4d (more details), 2.4 Å
SCOPe Domain Sequences for d3g4da2:
Sequence, based on SEQRES records: (download)
>d3g4da2 a.128.1.0 (A:227-554) automated matches {Gossypium arboreum [TaxId: 29729]} hnkallefakidfnmlqflhrkelseicrwwkdldfqrklpyardrvvegyfwisgvyfe pqyslgrkmltkviamasivddtydsyatyeelipytnaierwdikcideipeymkpsyk alldvyeemvqlvaehgrqyrveyaknamirlaqsylveakwtlqnykpsfeefkanalp tcgyamlaitsfvgmgdivtpetfkwaasdpkiiqastiicrfmddvaehkfkhrreddc saiecymeeygvtaqeaydvfnkhvesawkdlnqeflkptemptevlnrslnlarvmdvl yregdgytyvgkaakggitslliepial
>d3g4da2 a.128.1.0 (A:227-554) automated matches {Gossypium arboreum [TaxId: 29729]} hnkallefakidfnmlqflhrkelseicrwwkdldfqrklpyardrvvegyfwisgvyfe pqyslgrkmltkviamasivddtydsyatyeelipytnaierwdikcideipeymkpsyk alldvyeemvqlvaehgrqyrveyaknamirlaqsylveakwtlqnykpsfeefkanalp tcgyamlaitsfvgmgdivtpetfkwaasdpkiiqastiicrfmddvaehkfdcsaiecy meeygvtaqeaydvfnkhvesawkdlnqeflkptemptevlnrslnlarvmdvlyreyvg kaakggitslliepial
Timeline for d3g4da2: