Lineage for d3g3ka_ (3g3k A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1390576Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1390577Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1391676Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 1391677Protein automated matches [190039] (57 species)
    not a true protein
  7. 1391854Species Norway rat (Rattus norvegicus) [TaxId:10116] [186759] (69 PDB entries)
  8. 1391865Domain d3g3ka_: 3g3k A: [210344]
    automated match to d2znta_
    complexed with cl, glu, ipa, na; mutant

Details for d3g3ka_

PDB Entry: 3g3k (more details), 1.24 Å

PDB Description: crystal structure of the glur6 ligand binding domain dimer i442h k494e k665r i749l q753k e757q mutant with glutamate and nacl at 1.24 angstrom resolution
PDB Compounds: (A:) Glutamate receptor, ionotropic kainate 2

SCOPe Domain Sequences for d3g3ka_:

Sequence, based on SEQRES records: (download)

>d3g3ka_ c.94.1.0 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
nrslivttileepyvlfkksdkplygndrfegycidllrelsthlgftyeirlvedgkyg
aqddvngqwngmvrelidhkadlavaplaityvreevidfskpfmtlgisilyrkgtpid
saddlakqtkieygavedgatmtffkrskistydkmwafmssrrqsvlvksneegiqrvl
tsdyaflmesttiefvtqrncnltqigglidskgygvgtpmgspyrdkitlailklqeqg
klhmmkekwwrgngcp

Sequence, based on observed residues (ATOM records): (download)

>d3g3ka_ c.94.1.0 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
nrslivttileepyvlfkksdkplygndrfegycidllrelsthlgftyeirlvedgkyg
aqddvngqwngmvrelidhkadlavaplaityvreevidfskpfmtlgisilyrkgtpid
saddlakqtkieygavedgatmtffkrskistydkmwafmssrrqsvlvksneegiqrvl
tsdyaflmesttiefvtqrncnltqigglidskgygvgtpmgspyrdkitlailklqeqg
klhmmkekwwrgcp

SCOPe Domain Coordinates for d3g3ka_:

Click to download the PDB-style file with coordinates for d3g3ka_.
(The format of our PDB-style files is described here.)

Timeline for d3g3ka_: