SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3g3ja_ (3g3j A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2144291Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2144292Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2145531Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2145532Protein automated matches [190039] (136 species)
    not a true protein
  7. 2145930Species Norway rat (Rattus norvegicus) [TaxId:10116] [186759] (97 PDB entries)
  8. 2145933Domain d3g3ja_: 3g3j A: [210342]
    automated match to d2znta_
    complexed with cl, glu, na; mutant

Details for d3g3ja_

PDB Entry: 3g3j (more details), 1.32 Å

PDB Description: crystal structure of the glur6 ligand binding domain dimer i442h k494e k665r i749l q753k mutant with glutamate and nacl at 1.32 angstrom resolution
PDB Compounds: (A:) Glutamate receptor, ionotropic kainate 2

SCOPe Domain Sequences for d3g3ja_:

Sequence, based on SEQRES records: (download)

>d3g3ja_ c.94.1.0 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
nrslivttileepyvlfkksdkplygndrfegycidllrelsthlgftyeirlvedgkyg
aqddvngqwngmvrelidhkadlavaplaityvreevidfskpfmtlgisilyrkgtpid
saddlakqtkieygavedgatmtffkrskistydkmwafmssrrqsvlvksneegiqrvl
tsdyaflmesttiefvtqrncnltqigglidskgygvgtpmgspyrdkitlailklqeeg
klhmmkekwwrgngcpe

Sequence, based on observed residues (ATOM records): (download)

>d3g3ja_ c.94.1.0 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
nrslivttileepyvlfkksdkplygndrfegycidllrelsthlgftyeirlvedgkyg
aqddvngqwngmvrelidhkadlavaplaityvreevidfskpfmtlgisilyrkgtpid
saddlakqtkieygavedgatmtffkrskistydkmwafmssrrqsvlvksneegiqrvl
tsdyaflmesttiefvtqrncnltqigglidskgygvgtpmgspyrdkitlailklqeeg
klhmmkekwwrgcpe

SCOPe Domain Coordinates for d3g3ja_:

Click to download the PDB-style file with coordinates for d3g3ja_.
(The format of our PDB-style files is described here.)

Timeline for d3g3ja_: