Lineage for d3g3ia_ (3g3i A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2915150Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2915151Protein automated matches [190039] (161 species)
    not a true protein
  7. 2915760Species Norway rat (Rattus norvegicus) [TaxId:10116] [186759] (113 PDB entries)
  8. 2915774Domain d3g3ia_: 3g3i A: [210340]
    automated match to d2znta_
    complexed with cl, glu, na; mutant

Details for d3g3ia_

PDB Entry: 3g3i (more details), 1.37 Å

PDB Description: crystal structure of the glur6 ligand binding domain dimer i442h k494e i749l q753k mutant with glutamate and nacl at 1.37 angstrom resolution
PDB Compounds: (A:) Glutamate receptor, ionotropic kainate 2

SCOPe Domain Sequences for d3g3ia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3g3ia_ c.94.1.0 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
nrslivttileepyvlfkksdkplygndrfegycidllrelsthlgftyeirlvedgkyg
aqddvngqwngmvrelidhkadlavaplaityvreevidfskpfmtlgisilyrkgtpid
saddlakqtkieygavedgatmtffkkskistydkmwafmssrrqsvlvksneegiqrvl
tsdyaflmesttiefvtqrncnltqigglidskgygvgtpmgspyrdkitlailklqeeg
klhmmkekwwrgngcp

SCOPe Domain Coordinates for d3g3ia_:

Click to download the PDB-style file with coordinates for d3g3ia_.
(The format of our PDB-style files is described here.)

Timeline for d3g3ia_: