Lineage for d3g3hb1 (3g3h B:2-257)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2162067Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2162068Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2163419Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2163420Protein automated matches [190039] (140 species)
    not a true protein
  7. 2163929Species Norway rat (Rattus norvegicus) [TaxId:10116] [186759] (101 PDB entries)
  8. 2163944Domain d3g3hb1: 3g3h B:2-257 [210339]
    Other proteins in same PDB: d3g3hb2
    automated match to d2znta_
    complexed with cl, glu, na; mutant

Details for d3g3hb1

PDB Entry: 3g3h (more details), 1.5 Å

PDB Description: crystal structure of the glur6 ligand binding domain dimer k665r i749l q753k mutant with glutamate and nacl at 1.5 angstrom resolution
PDB Compounds: (B:) Glutamate receptor, ionotropic kainate 2

SCOPe Domain Sequences for d3g3hb1:

Sequence, based on SEQRES records: (download)

>d3g3hb1 c.94.1.0 (B:2-257) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
snrslivttileepyvlfkksdkplygndrfegycidllrelstilgftyeirlvedgky
gaqddvngqwngmvrelidhkadlavaplaityvrekvidfskpfmtlgisilyrkgtpi
dsaddlakqtkieygavedgatmtffkrskistydkmwafmssrrqsvlvksneegiqrv
ltsdyaflmesttiefvtqrncnltqigglidskgygvgtpmgspyrdkitlailklqee
gklhmmkekwwrgngc

Sequence, based on observed residues (ATOM records): (download)

>d3g3hb1 c.94.1.0 (B:2-257) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
snrslivttileepyvlfkksdkplygndrfegycidllrelstilgftyeirlvedgky
gaqddvngqwngmvrelidhkadlavaplaityvrekvidfskpfmtlgisilyrkgtpi
dsaddlakqtkieygavedgatmtffkrskistydkmwafmssrrqsvlvksneegiqrv
ltsdyaflmesttiefvtqrncnltqigglidskgygvgtpmgspyrdkitlailklqee
gklhmmkekwwc

SCOPe Domain Coordinates for d3g3hb1:

Click to download the PDB-style file with coordinates for d3g3hb1.
(The format of our PDB-style files is described here.)

Timeline for d3g3hb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3g3hb2
View in 3D
Domains from other chains:
(mouse over for more information)
d3g3ha_