SCOPe 2.03: Domain d3g3gb_: 3g3g B:

Lineage for d3g3gb_ (3g3g B:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (57 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [186759] (69 PDB entries)

8. Domain d3g3gb_: 3g3g B: [210337]
   automated match to d2znta_
   complexed with cl, glu, na; mutant

Details for d3g3gb_

PDB Entry: 3g3g, 1.3 Å

PDB Description: crystal structure of the glur6 ligand binding domain dimer k665r mutant with glutamate and nacl at 1.3 angstrom resolution

PDB Compounds: (B:) Glutamate receptor, ionotropic kainate 2

SCOPe Domain Sequences for d3g3gb_:

Sequence, based on SEQRES records:

>d3g3gb_ c.94.1.0 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
snrslivttileepyvlfkksdkplygndrfegycidllrelstilgftyeirlvedgky
gaqddvngqwngmvrelidhkadlavaplaityvrekvidfskpfmtlgisilyrkgtpi
dsaddlakqtkieygavedgatmtffkrskistydkmwafmssrrqsvlvksneegiqrv
ltsdyaflmesttiefvtqrncnltqigglidskgygvgtpmgspyrdkitiailqlqee
gklhmmkekwwrgngc

Sequence, based on observed residues (ATOM records):

>d3g3gb_ c.94.1.0 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
snrslivttileepyvlfkksdkplygndrfegycidllrelstilgftyeirlvedgky
gaqddvngqwngmvrelidhkadlavaplaityvrekvidfskpfmtlgisilyrkgtpi
dsaddlakqtkieygavedgatmtffkrskistydkmwafmssrrqsvlvksneegiqrv
ltsdyaflmesttiefvtqrncnltqigglidskgygvgtpmgspyrdkitiailqlqee
gklhmmkekwwrc

Timeline for d3g3gb_:

• d3g3gb_ is new in SCOPe 2.03-stable
  
• d3g3gb_ appears in SCOPe 2.04
  
• d3g3gb_ appears in the current release, SCOPe 2.08