Lineage for d3g3fb1 (3g3f B:2-117,B:120-257)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2144291Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2144292Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2144293Family c.94.1.1: Phosphate binding protein-like [53851] (45 protein domains)
  6. 2144526Protein Glutamate receptor ligand binding core [53881] (5 species)
  7. 2144863Species Norway rat (Rattus norvegicus), GluR6 [TaxId:10116] [142801] (3 PDB entries)
    Uniprot P42260 421-544,668-804! Uniprot P42260 429-544,667-806
  8. 2144864Domain d3g3fb1: 3g3f B:2-117,B:120-257 [210335]
    Other proteins in same PDB: d3g3fa_
    automated match to d1s50a1
    complexed with cl, glu, ipa, na

Details for d3g3fb1

PDB Entry: 3g3f (more details), 1.38 Å

PDB Description: crystal structure of the glur6 ligand binding domain dimer with glutamate and nacl at 1.38 angstrom resolution
PDB Compounds: (B:) Glutamate receptor, ionotropic kainate 2

SCOPe Domain Sequences for d3g3fb1:

Sequence, based on SEQRES records: (download)

>d3g3fb1 c.94.1.1 (B:2-117,B:120-257) Glutamate receptor ligand binding core {Norway rat (Rattus norvegicus), GluR6 [TaxId: 10116]}
snrslivttileepyvlfkksdkplygndrfegycidllrelstilgftyeirlvedgky
gaqddvngqwngmvrelidhkadlavaplaityvrekvidfskpfmtlgisilyrkXpid
saddlakqtkieygavedgatmtffkkskistydkmwafmssrrqsvlvksneegiqrvl
tsdyaflmesttiefvtqrncnltqigglidskgygvgtpmgspyrdkitiailqlqeeg
klhmmkekwwrgngc

Sequence, based on observed residues (ATOM records): (download)

>d3g3fb1 c.94.1.1 (B:2-117,B:120-257) Glutamate receptor ligand binding core {Norway rat (Rattus norvegicus), GluR6 [TaxId: 10116]}
snrslivttileepyvlfkksdkplygndrfegycidllrelstilgftyeirlvedgky
gaqddvngqwngmvrelidhkadlavaplaityvrekvidfskpfmtlgisilyrkXpid
saddlakqtkieygavedgatmtffkkskistydkmwafmssrrqsvlvksneegiqrvl
tsdyaflmesttiefvtqrncnltqigglidskgygvgtpmgspyrdkitiailqlqeeg
klhmmkekwwrgc

SCOPe Domain Coordinates for d3g3fb1:

Click to download the PDB-style file with coordinates for d3g3fb1.
(The format of our PDB-style files is described here.)

Timeline for d3g3fb1: