SCOP 1.65: Domain d3hfmh2: 3hfm H:114-215

Lineage for d3hfmh2 (3hfm H:114-215)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88576] (237 PDB entries)

8. Domain d3hfmh2: 3hfm H:114-215 [21033]
   Other proteins in same PDB: d3hfmh1, d3hfml1, d3hfml2, d3hfmy_
   part of Fab HyHEL-10

Details for d3hfmh2

PDB Entry: 3hfm, 3 Å

PDB Description: structure of an antibody-antigen complex. crystal structure of the hy/hel-10 fab-lysozyme complex

SCOP Domain Sequences for d3hfmh2:

Sequence; same for both SEQRES and ATOM records:

>d3hfmh2 b.1.1.2 (H:114-215) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpssprpsetvtcnvahpasstkvdkkivprdc

Timeline for d3hfmh2:

• d3hfmh2 first appeared (with stable ids) in SCOP 1.55
  
• d3hfmh2 appears in SCOP 1.63
  
• d3hfmh2 appears in SCOP 1.67
  
• d3hfmh2 appears in the current release, SCOPe 2.08