SCOP 1.55: Domain d3hfmh2: 3hfm H:114-215

Lineage for d3hfmh2 (3hfm H:114-215)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)

7. Species Fab HyHEL-10 (mouse), kappa L chain [49008] (1 PDB entry)

8. Domain d3hfmh2: 3hfm H:114-215 [21033]
   Other proteins in same PDB: d3hfmh1, d3hfml1, d3hfmy_

Details for d3hfmh2

PDB Entry: 3hfm, 3 Å

PDB Description: structure of an antibody-antigen complex. crystal structure of the hy/hel-10 fab-lysozyme complex

SCOP Domain Sequences for d3hfmh2:

Sequence; same for both SEQRES and ATOM records:

>d3hfmh2 b.1.1.2 (H:114-215) Immunoglobulin (constant domains of L and H chains) {Fab HyHEL-10 (mouse), kappa L chain}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpssprpsetvtcnvahpasstkvdkkivprdc

Timeline for d3hfmh2:

• d3hfmh2 appears in SCOP 1.57
  
• d3hfmh2 appears in the current release, SCOPe 2.08