Lineage for d3g29a_ (3g29 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706108Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 2706465Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families) (S)
  5. 2706466Family a.28.3.1: Retrovirus capsid protein C-terminal domain [47354] (5 proteins)
  6. 2706520Protein automated matches [226861] (4 species)
    not a true protein
  7. 2706537Species Rous sarcoma virus [TaxId:11888] [225677] (7 PDB entries)
  8. 2706546Domain d3g29a_: 3g29 A: [210324]
    automated match to d1eoqa_
    mutant

Details for d3g29a_

PDB Entry: 3g29 (more details), 2.5 Å

PDB Description: crystal structure of the c-terminal domain of the rous sarcoma virus capsid protein: d179n mutant, neutral ph
PDB Compounds: (A:) gag polyprotein

SCOPe Domain Sequences for d3g29a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3g29a_ a.28.3.1 (A:) automated matches {Rous sarcoma virus [TaxId: 11888]}
agpwadimqgpsesfvdfanrlikavegsnlppsarapviidcfrqksqpdiqqlirtap
stlttpgeiikyvldrq

SCOPe Domain Coordinates for d3g29a_:

Click to download the PDB-style file with coordinates for d3g29a_.
(The format of our PDB-style files is described here.)

Timeline for d3g29a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3g29b_