Lineage for d3g1rb_ (3g1r B:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1338786Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. 1338787Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins)
    Common fold covers whole protein structure
  6. 1339058Protein automated matches [190169] (4 species)
    not a true protein
  7. 1339059Species Human (Homo sapiens) [TaxId:9606] [188399] (51 PDB entries)
  8. 1339089Domain d3g1rb_: 3g1r B: [210312]
    automated match to d3caqb_
    complexed with fit, nap

Details for d3g1rb_

PDB Entry: 3g1r (more details), 1.7 Å

PDB Description: crystal structure of human liver 5beta-reductase (akr1d1) in complex with nadp and finasteride. resolution 1.70 a
PDB Compounds: (B:) 3-oxo-5-beta-steroid 4-dehydrogenase

SCOPe Domain Sequences for d3g1rb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3g1rb_ c.1.7.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlsaashriplsdgnsipiiglgtysepkstpkgacatsvkvaidtgyrhidgayiyqne
hevgeairekiaegkvrredifycgklwatnhvpemvrptlertlrvlqldyvdlyiiev
pmafkpgdeiyprdengkwlyhksnlcatweameackdaglvkslgvsnfnrrqleliln
kpglkhkpvsnqvechpyftqpkllkfcqqhdivitaysplgtsrnpiwvnvssppllkd
allnslgkrynktaaqivlrfniqrgvvvipksfnlerikenfqifdfslteeemkdiea
lnknvrfvellmwrdhpeypfhdey

SCOPe Domain Coordinates for d3g1rb_:

Click to download the PDB-style file with coordinates for d3g1rb_.
(The format of our PDB-style files is described here.)

Timeline for d3g1rb_: