Lineage for d2iffh2 (2iff H:117-215)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 8163Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 8462Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)
  7. 8990Species Fab HyHEL-5 (mouse), kappa L chain [49007] (3 PDB entries)
  8. 8995Domain d2iffh2: 2iff H:117-215 [21031]
    Other proteins in same PDB: d2iffh1, d2iffl1, d2iffy_

Details for d2iffh2

PDB Entry: 2iff (more details), 2.65 Å

PDB Description: structure of an antibody-lysozyme complex: effect of a conservative mutation

SCOP Domain Sequences for d2iffh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iffh2 b.1.1.2 (H:117-215) Immunoglobulin (constant domains of L and H chains) {Fab HyHEL-5 (mouse), kappa L chain}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpssprpsetvtcnvahpasstkvdkkivp

SCOP Domain Coordinates for d2iffh2:

Click to download the PDB-style file with coordinates for d2iffh2.
(The format of our PDB-style files is described here.)

Timeline for d2iffh2: