![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
![]() | Superfamily c.95.1: Thiolase-like [53901] (3 families) ![]() |
![]() | Family c.95.1.0: automated matches [196908] (1 protein) not a true family |
![]() | Protein automated matches [196909] (83 species) not a true protein |
![]() | Species Escherichia coli K-12 [TaxId:83333] [225630] (7 PDB entries) |
![]() | Domain d3g11a1: 3g11 A:2-251 [210303] automated match to d1e5ma1 complexed with p9c |
PDB Entry: 3g11 (more details), 2 Å
SCOPe Domain Sequences for d3g11a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3g11a1 c.95.1.0 (A:2-251) automated matches {Escherichia coli K-12 [TaxId: 83333]} krrvvvtglgmlspvgntvestwkallagqsgislidhfdtsayatkfaglvkdfncedi isrkeqrkmdafiqygivagvqamqdsgleiteenatrigaaigsgigglglieenhtsl mnggprkispffvpstivnmvaghltimyglrgpsisiataqtsgvhnighaariiaygd advmvaggaekastplgvggfgaaralstrndnpqaasrpwdkerdgfvlgdgagmlvle eyehakkrga
Timeline for d3g11a1: