Lineage for d3g0ya2 (3g0y A:252-412)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2523777Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2523778Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2524590Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 2524591Protein automated matches [196909] (81 species)
    not a true protein
  7. 2524904Species Escherichia coli K-12 [TaxId:83333] [225630] (7 PDB entries)
  8. 2524918Domain d3g0ya2: 3g0y A:252-412 [210302]
    automated match to d1e5ma2
    complexed with p9a

Details for d3g0ya2

PDB Entry: 3g0y (more details), 2.6 Å

PDB Description: structure of e. coli fabf(c163q) in complex with dihydroplatensimycin
PDB Compounds: (A:) 3-oxoacyl-[acyl-carrier-protein] synthase 2

SCOPe Domain Sequences for d3g0ya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3g0ya2 c.95.1.0 (A:252-412) automated matches {Escherichia coli K-12 [TaxId: 83333]}
kiyaelvgfgmssdayhmtsppengagaalamanalrdagieasqigyvnahgtstpagd
kaeaqavktifgeaasrvlvsstksmtghllgaagavesiysilalrdqavpptinldnp
degcdldfvphearqvsgmeytlcnsfgfggtngslifkki

SCOPe Domain Coordinates for d3g0ya2:

Click to download the PDB-style file with coordinates for d3g0ya2.
(The format of our PDB-style files is described here.)

Timeline for d3g0ya2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3g0ya1