SCOP 1.69: Domain d2iffl2: 2iff L:107-212

Lineage for d2iffl2 (2iff L:107-212)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88567] (277 PDB entries)

8. Domain d2iffl2: 2iff L:107-212 [21030]
   Other proteins in same PDB: d2iffh1, d2iffh2, d2iffl1, d2iffy_
   part of Fab HyHEL-5

Details for d2iffl2

PDB Entry: 2iff, 2.65 Å

PDB Description: structure of an antibody-lysozyme complex: effect of a conservative mutation

SCOP Domain Sequences for d2iffl2:

Sequence; same for both SEQRES and ATOM records:

>d2iffl2 b.1.1.2 (L:107-212) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds
kdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

Timeline for d2iffl2:

• d2iffl2 first appeared (with stable ids) in SCOP 1.55
  
• d2iffl2 appears in SCOP 1.67
  
• d2iffl2 appears in SCOP 1.71
  
• d2iffl2 appears in the current release, SCOPe 2.08