Lineage for d2iffl2 (2iff L:107-212)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 103279Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 103650Protein Immunoglobulin (constant domains of L and H chains) [48972] (169 species)
  7. 104255Species Fab HyHEL-5 (mouse), kappa L chain [49007] (3 PDB entries)
  8. 104261Domain d2iffl2: 2iff L:107-212 [21030]
    Other proteins in same PDB: d2iffh1, d2iffl1, d2iffy_

Details for d2iffl2

PDB Entry: 2iff (more details), 2.65 Å

PDB Description: structure of an antibody-lysozyme complex: effect of a conservative mutation

SCOP Domain Sequences for d2iffl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iffl2 b.1.1.2 (L:107-212) Immunoglobulin (constant domains of L and H chains) {Fab HyHEL-5 (mouse), kappa L chain}
adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds
kdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOP Domain Coordinates for d2iffl2:

Click to download the PDB-style file with coordinates for d2iffl2.
(The format of our PDB-style files is described here.)

Timeline for d2iffl2: