Lineage for d3g0sb_ (3g0s B:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1342158Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 1343361Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 1343362Protein automated matches [190115] (51 species)
    not a true protein
  7. 1343675Species Salmonella typhimurium [TaxId:99287] [225609] (1 PDB entry)
  8. 1343677Domain d3g0sb_: 3g0s B: [210299]
    automated match to d3l21a_
    complexed with cl, gol, mg

Details for d3g0sb_

PDB Entry: 3g0s (more details), 1.85 Å

PDB Description: dihydrodipicolinate synthase from salmonella typhimurium lt2
PDB Compounds: (B:) Dihydrodipicolinate synthase

SCOPe Domain Sequences for d3g0sb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3g0sb_ c.1.10.0 (B:) automated matches {Salmonella typhimurium [TaxId: 99287]}
namftgsivalvtpmdekgnvsrsclkklidyhvangtsaivsvgttgesatlshdehgd
vvmmtleladgripviagtganataeaisltqrfndsgivgcltvtpyynrptqeglfqh
fkaiaehtdlpqilynvpsrtgcdmlpetvgrlaeikniiaikeatgnltrvhqikelvs
ddfillsgddasaldfmqlgghgvisvtanvaaremadmcklaaegqfaearainqrlmp
lhnklfvepnpipvkwackalglvatdtlrlpmtpitdhgrdivkaalqhagll

SCOPe Domain Coordinates for d3g0sb_:

Click to download the PDB-style file with coordinates for d3g0sb_.
(The format of our PDB-style files is described here.)

Timeline for d3g0sb_: