Lineage for d3g0sa1 (3g0s A:1-292)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2443024Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2444581Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2444582Protein automated matches [190115] (91 species)
    not a true protein
  7. 2445193Species Salmonella typhimurium [TaxId:99287] [225609] (1 PDB entry)
  8. 2445194Domain d3g0sa1: 3g0s A:1-292 [210298]
    Other proteins in same PDB: d3g0sa2, d3g0sb2
    automated match to d3l21a_
    complexed with cl, gol, mg

Details for d3g0sa1

PDB Entry: 3g0s (more details), 1.85 Å

PDB Description: dihydrodipicolinate synthase from salmonella typhimurium lt2
PDB Compounds: (A:) Dihydrodipicolinate synthase

SCOPe Domain Sequences for d3g0sa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3g0sa1 c.1.10.0 (A:1-292) automated matches {Salmonella typhimurium [TaxId: 99287]}
mftgsivalvtpmdekgnvsrsclkklidyhvangtsaivsvgttgesatlshdehgdvv
mmtleladgripviagtganataeaisltqrfndsgivgcltvtpyynrptqeglfqhfk
aiaehtdlpqilynvpsrtgcdmlpetvgrlaeikniiaikeatgnltrvhqikelvsdd
fillsgddasaldfmqlgghgvisvtanvaaremadmcklaaegqfaearainqrlmplh
nklfvepnpipvkwackalglvatdtlrlpmtpitdhgrdivkaalqhagll

SCOPe Domain Coordinates for d3g0sa1:

Click to download the PDB-style file with coordinates for d3g0sa1.
(The format of our PDB-style files is described here.)

Timeline for d3g0sa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3g0sa2