Lineage for d3g0qa2 (3g0q A:234-360)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1666148Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 1666149Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 1666378Family d.113.1.3: MutY C-terminal domain-like [103211] (2 proteins)
  6. 1666382Protein Adenine glycosylase MutY, C-terminal domain [103212] (1 species)
  7. 1666383Species Bacillus stearothermophilus [TaxId:1422] [103213] (4 PDB entries)
  8. 1666385Domain d3g0qa2: 3g0q A:234-360 [210297]
    Other proteins in same PDB: d3g0qa1
    automated match to d1rrqa2
    protein/DNA complex; complexed with ca, sf4

Details for d3g0qa2

PDB Entry: 3g0q (more details), 2.2 Å

PDB Description: crystal structure of muty bound to its inhibitor dna
PDB Compounds: (A:) A/G-specific adenine glycosylase

SCOPe Domain Sequences for d3g0qa2:

Sequence, based on SEQRES records: (download)

>d3g0qa2 d.113.1.3 (A:234-360) Adenine glycosylase MutY, C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]}
vkqvplavavladdegrvlirkrdstgllanlwefpscetdgadgkekleqmvgeqyglq
veltepivsfehafshlvwqltvfpgrlvhggpveepyrlapedelkayafpvshqrvwr
eykewas

Sequence, based on observed residues (ATOM records): (download)

>d3g0qa2 d.113.1.3 (A:234-360) Adenine glycosylase MutY, C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]}
vkqvplavavladdegrvlirkrdstgllanlwefpscetdgadgkekleqmvglqvelt
epivsfehafshlvwqltvfpgrlvhggpveepyrlapedelkayafpvshqrvwreyke
was

SCOPe Domain Coordinates for d3g0qa2:

Click to download the PDB-style file with coordinates for d3g0qa2.
(The format of our PDB-style files is described here.)

Timeline for d3g0qa2: