SCOPe 2.07: Domain d3g0qa1: 3g0q A:9-229

Lineage for d3g0qa1 (3g0q A:9-229)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.96: DNA-glycosylase [48149] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.96.1: DNA-glycosylase [48150] (7 families)

5. Family a.96.1.2: Mismatch glycosylase [48154] (4 proteins)

6. Protein Catalytic domain of MutY [48155] (2 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [101348] (5 PDB entries)

8. Domain d3g0qa1: 3g0q A:9-229 [210296]
   Other proteins in same PDB: d3g0qa2
   automated match to d1rrqa1
   protein/DNA complex; complexed with ca, sf4

Details for d3g0qa1

PDB Entry: 3g0q, 2.2 Å

PDB Description: crystal structure of muty bound to its inhibitor dna

PDB Compounds: (A:) A/G-specific adenine glycosylase

SCOPe Domain Sequences for d3g0qa1:

Sequence; same for both SEQRES and ATOM records:

>d3g0qa1 a.96.1.2 (A:9-229) Catalytic domain of MutY {Bacillus stearothermophilus [TaxId: 1422]}
parefqrdlldwfarerrdlpwrkdrdpykvwvsevmlqqtrvetvipyfeqfidrfptl
ealadadedevlkaweglgyysrvrnlhaavkevktryggkvpddpdefsrlkgvgpytv
gavlslaygvpepavdgnvmrvlsrlflvtddiakcstrkrfeqivreimayenpgafne
alielgalvctprrpscllcpvqaycqafaegvaeelpvkm

Timeline for d3g0qa1:

• d3g0qa1 first appeared in SCOPe 2.03
  
• d3g0qa1 appears in SCOPe 2.06
  
• d3g0qa1 appears in the current release, SCOPe 2.08