Lineage for d3g0qa1 (3g0q A:9-229)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006171Fold a.96: DNA-glycosylase [48149] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2006172Superfamily a.96.1: DNA-glycosylase [48150] (7 families) (S)
  5. 2006180Family a.96.1.2: Mismatch glycosylase [48154] (4 proteins)
  6. 2006181Protein Catalytic domain of MutY [48155] (2 species)
  7. 2006182Species Bacillus stearothermophilus [TaxId:1422] [101348] (5 PDB entries)
  8. 2006184Domain d3g0qa1: 3g0q A:9-229 [210296]
    Other proteins in same PDB: d3g0qa2
    automated match to d1rrqa1
    protein/DNA complex; complexed with ca, sf4

Details for d3g0qa1

PDB Entry: 3g0q (more details), 2.2 Å

PDB Description: crystal structure of muty bound to its inhibitor dna
PDB Compounds: (A:) A/G-specific adenine glycosylase

SCOPe Domain Sequences for d3g0qa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3g0qa1 a.96.1.2 (A:9-229) Catalytic domain of MutY {Bacillus stearothermophilus [TaxId: 1422]}
parefqrdlldwfarerrdlpwrkdrdpykvwvsevmlqqtrvetvipyfeqfidrfptl
ealadadedevlkaweglgyysrvrnlhaavkevktryggkvpddpdefsrlkgvgpytv
gavlslaygvpepavdgnvmrvlsrlflvtddiakcstrkrfeqivreimayenpgafne
alielgalvctprrpscllcpvqaycqafaegvaeelpvkm

SCOPe Domain Coordinates for d3g0qa1:

Click to download the PDB-style file with coordinates for d3g0qa1.
(The format of our PDB-style files is described here.)

Timeline for d3g0qa1: