Lineage for d3g0dc1 (3g0d C:41-508)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2066579Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies)
    consists of eight 4-stranded beta-sheet motifs; meander
    also found in some members of the WD40-repeat superfamily
  4. 2066692Superfamily b.70.3: DPP6 N-terminal domain-like [82171] (1 family) (S)
    automatically mapped to Pfam PF00930
  5. 2066693Family b.70.3.1: DPP6 N-terminal domain-like [82172] (3 protein domains)
    Pfam PF00930
  6. 2066700Protein Dipeptidyl peptidase IV/CD26, N-terminal domain [82173] (2 species)
  7. 2066701Species Human (Homo sapiens) [TaxId:9606] [82174] (93 PDB entries)
    Uniprot P27487 39-776 ! Uniprot P27487 ! Uniprot P27487
  8. 2066782Domain d3g0dc1: 3g0d C:41-508 [210281]
    Other proteins in same PDB: d3g0da2, d3g0db2, d3g0db3, d3g0dc2, d3g0dd2
    automated match to d1orva1
    complexed with nag, xih

Details for d3g0dc1

PDB Entry: 3g0d (more details), 2.39 Å

PDB Description: crystal structure of dipeptidyl peptidase iv in complex with a pyrimidinedione inhibitor 2
PDB Compounds: (C:) dipeptidyl peptidase 4

SCOPe Domain Sequences for d3g0dc1:

Sequence, based on SEQRES records: (download)

>d3g0dc1 b.70.3.1 (C:41-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
ktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflenstfdefgh
sindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtwspv
ghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwwspng
tflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdslssvt
natsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrwncl
varqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctfitkg
twevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercqyysvs
fskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvq

Sequence, based on observed residues (ATOM records): (download)

>d3g0dc1 b.70.3.1 (C:41-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
ktytltdylkntyrlklyslrwisdheylyknilvfnaeygnssvflenstfdefghsin
dysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtwspvghk
layvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwwspngtfl
ayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdslssvtnat
siqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrwnclvar
qhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctfitkgtwe
vigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercqyysvsfsk
eakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvq

SCOPe Domain Coordinates for d3g0dc1:

Click to download the PDB-style file with coordinates for d3g0dc1.
(The format of our PDB-style files is described here.)

Timeline for d3g0dc1: