![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
![]() | Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) ![]() many members have left-handed crossover connection between strand 8 and additional strand 9 |
![]() | Family c.69.1.0: automated matches [191404] (1 protein) not a true family |
![]() | Protein automated matches [190543] (131 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188340] (99 PDB entries) |
![]() | Domain d3g0cc2: 3g0c C:509-766 [210274] Other proteins in same PDB: d3g0ca1, d3g0cb1, d3g0cb3, d3g0cc1, d3g0cd1 automated match to d1orva2 complexed with nag, ruf |
PDB Entry: 3g0c (more details), 2.69 Å
SCOPe Domain Sequences for d3g0cc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3g0cc2 c.69.1.0 (C:509-766) automated matches {Human (Homo sapiens) [TaxId: 9606]} mpskkldfiilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatyla steniivasfdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwg wsyggyvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstv msraenfkqveyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstah qhiythmshfikqcfslp
Timeline for d3g0cc2: