Lineage for d3g0cb2 (3g0c B:509-766)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1615834Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 1615835Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 1617684Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 1617685Protein automated matches [190543] (56 species)
    not a true protein
  7. 1617800Species Human (Homo sapiens) [TaxId:9606] [188340] (44 PDB entries)
  8. 1617863Domain d3g0cb2: 3g0c B:509-766 [210272]
    Other proteins in same PDB: d3g0ca1, d3g0cb1, d3g0cc1, d3g0cd1
    automated match to d1orva2
    complexed with nag, ruf

Details for d3g0cb2

PDB Entry: 3g0c (more details), 2.69 Å

PDB Description: crystal structure of dipeptidyl peptidase iv in complex with a pyrimidinedione inhibitor 1
PDB Compounds: (B:) dipeptidyl peptidase 4

SCOPe Domain Sequences for d3g0cb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3g0cb2 c.69.1.0 (B:509-766) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mpskkldfiilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatyla
steniivasfdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwg
wsyggyvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstv
msraenfkqveyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstah
qhiythmshfikqcfslp

SCOPe Domain Coordinates for d3g0cb2:

Click to download the PDB-style file with coordinates for d3g0cb2.
(The format of our PDB-style files is described here.)

Timeline for d3g0cb2: