Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.0: automated matches [191404] (1 protein) not a true family |
Protein automated matches [190543] (56 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188340] (44 PDB entries) |
Domain d3g0cb2: 3g0c B:509-766 [210272] Other proteins in same PDB: d3g0ca1, d3g0cb1, d3g0cc1, d3g0cd1 automated match to d1orva2 complexed with nag, ruf |
PDB Entry: 3g0c (more details), 2.69 Å
SCOPe Domain Sequences for d3g0cb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3g0cb2 c.69.1.0 (B:509-766) automated matches {Human (Homo sapiens) [TaxId: 9606]} mpskkldfiilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatyla steniivasfdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwg wsyggyvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstv msraenfkqveyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstah qhiythmshfikqcfslp
Timeline for d3g0cb2: