![]() | Class b: All beta proteins [48724] (149 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
![]() | Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [88567] (284 PDB entries) |
![]() | Domain d3hfll2: 3hfl L:107-214 [21026] Other proteins in same PDB: d3hflh1, d3hflh2, d3hfll1, d3hfly_ part of Fab HyHEL-5 |
PDB Entry: 3hfl (more details), 2.65 Å
SCOP Domain Sequences for d3hfll2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hfll2 b.1.1.2 (L:107-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)} kradaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdq dskdstysmsstltltkdeyerhnsytceathktstspivksfnrnec
Timeline for d3hfll2: