SCOP 1.65: Domain d3hfll2: 3hfl L:107-214

Lineage for d3hfll2 (3hfl L:107-214)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88567] (225 PDB entries)

8. Domain d3hfll2: 3hfl L:107-214 [21026]
   Other proteins in same PDB: d3hflh1, d3hflh2, d3hfll1, d3hfly_
   part of Fab HyHEL-5

Details for d3hfll2

PDB Entry: 3hfl, 2.65 Å

PDB Description: the refined structure of the monoclonal antibody hy(slash)hel-5 with its antigen hen egg white lysozyme

SCOP Domain Sequences for d3hfll2:

Sequence; same for both SEQRES and ATOM records:

>d3hfll2 b.1.1.2 (L:107-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
kradaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdq
dskdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

Timeline for d3hfll2:

• d3hfll2 first appeared (with stable ids) in SCOP 1.55
  
• d3hfll2 appears in SCOP 1.63
  
• d3hfll2 appears in SCOP 1.67
  
• d3hfll2 last appears in SCOP 1.71