Class b: All beta proteins [48724] (110 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Immunoglobulin (constant domains of L and H chains) [48972] (169 species) |
Species Fab HyHEL-5 (mouse), kappa L chain [49007] (3 PDB entries) |
Domain d3hfll2: 3hfl L:107-214 [21026] Other proteins in same PDB: d3hflh1, d3hfll1, d3hfly_ |
PDB Entry: 3hfl (more details), 2.65 Å
SCOP Domain Sequences for d3hfll2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hfll2 b.1.1.2 (L:107-214) Immunoglobulin (constant domains of L and H chains) {Fab HyHEL-5 (mouse), kappa L chain} kradaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdq dskdstysmsstltltkdeyerhnsytceathktstspivksfnrnec
Timeline for d3hfll2: