SCOPe 2.08: Domain d3fzud2: 3fzu D:108-213

Lineage for d3fzud2 (3fzu D:108-213)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d3fzud2: 3fzu D:108-213 [210258]
   Other proteins in same PDB: d3fzuc_, d3fzud1, d3fzuh_, d3fzul1
   automated match to d1rhha2

Details for d3fzud2

PDB Entry: 3fzu, 2.5 Å

PDB Description: IgG1 Fab characterized by H/D exchange

PDB Compounds: (D:) immunoglobulin IgG1 Fab, light chain

SCOPe Domain Sequences for d3fzud2:

Sequence; same for both SEQRES and ATOM records:

>d3fzud2 b.1.1.2 (D:108-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

Timeline for d3fzud2:

• d3fzud2 first appeared in SCOPe 2.03
  
• d3fzud2 appears in SCOPe 2.07