SCOPe 2.05: Domain d3fyha1: 3fyh A:5-64

Lineage for d3fyha1 (3fyh A:5-64)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.4: Rad51 N-terminal domain-like [47794] (4 families)
   contains one classic and one pseudo HhH motifs

5. Family a.60.4.1: DNA repair protein Rad51, N-terminal domain [47795] (1 protein)

6. Protein DNA repair protein Rad51, N-terminal domain [47796] (7 species)

7. Species Methanococcus voltae [TaxId:2188] [109872] (8 PDB entries)
   Uniprot O73948

8. Domain d3fyha1: 3fyh A:5-64 [210253]
   Other proteins in same PDB: d3fyha2
   automated match to d1t4ga1
   protein/DNA complex; complexed with adp, mg, na, w

Details for d3fyha1

PDB Entry: 3fyh, 1.9 Å

PDB Description: recombinase in complex with adp and metatungstate

PDB Compounds: (A:) DNA repair and recombination protein radA

SCOPe Domain Sequences for d3fyha1:

Sequence; same for both SEQRES and ATOM records:

>d3fyha1 a.60.4.1 (A:5-64) DNA repair protein Rad51, N-terminal domain {Methanococcus voltae [TaxId: 2188]}
ltdlpgvgpstaeklveagyidfmkiatatvgeltdiegisekaaakmimgardlcdlgf

Timeline for d3fyha1:

• d3fyha1 first appeared in SCOPe 2.03
  
• d3fyha1 appears in SCOPe 2.04
  
• d3fyha1 appears in SCOPe 2.06
  
• d3fyha1 appears in the current release, SCOPe 2.08