SCOPe 2.06: Domain d3fybb1: 3fyb B:1-87

Lineage for d3fybb1 (3fyb B:1-87)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.293: SMc04008-like [158756] (1 superfamily)
   multihelcal; intertwined homodimer; there are 4 core helices in each subunits; contains putative metal ion-binding motif MxxxxxCxxC in the conserved surface site

4. Superfamily a.293.1: SMc04008-like [158757] (2 families)

5. Family a.293.1.0: automated matches [227238] (1 protein)
   not a true family

6. Protein automated matches [226996] (1 species)
   not a true protein

7. Species Alcanivorax borkumensis [TaxId:393595] [225608] (1 PDB entry)

8. Domain d3fybb1: 3fyb B:1-87 [210252]
   Other proteins in same PDB: d3fyba2, d3fybb2
   automated match to d2o35a1
   complexed with ca, cl, edo, peg

Details for d3fybb1

PDB Entry: 3fyb, 1.8 Å

PDB Description: Crystal structure of a protein of unknown function (DUF1244) from Alcanivorax borkumensis

PDB Compounds: (B:) Protein of unknown function (DUF1244)

SCOPe Domain Sequences for d3fybb1:

Sequence; same for both SEQRES and ATOM records:

>d3fybb1 a.293.1.0 (B:1-87) automated matches {Alcanivorax borkumensis [TaxId: 393595]}
madidqasktemeaaafrhllrhldehkdvqnidlmiqadfcrnclakwlmeaateqgve
ldydgareyvygmpfaewktlyqkpas

Timeline for d3fybb1:

• d3fybb1 first appeared in SCOPe 2.03, called d3fybb_
  
• d3fybb1 was called d3fybb_ in SCOPe 2.05
  
• d3fybb1 appears in SCOPe 2.07
  
• d3fybb1 appears in the current release, SCOPe 2.08