Lineage for d3fybb1 (3fyb B:1-87)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2739298Fold a.293: SMc04008-like [158756] (1 superfamily)
    multihelcal; intertwined homodimer; there are 4 core helices in each subunits; contains putative metal ion-binding motif MxxxxxCxxC in the conserved surface site
  4. 2739299Superfamily a.293.1: SMc04008-like [158757] (2 families) (S)
  5. 2739305Family a.293.1.0: automated matches [227238] (1 protein)
    not a true family
  6. 2739306Protein automated matches [226996] (1 species)
    not a true protein
  7. 2739307Species Alcanivorax borkumensis [TaxId:393595] [225608] (1 PDB entry)
  8. 2739309Domain d3fybb1: 3fyb B:1-87 [210252]
    Other proteins in same PDB: d3fyba2, d3fybb2
    automated match to d2o35a1
    complexed with ca, cl, edo, peg

Details for d3fybb1

PDB Entry: 3fyb (more details), 1.8 Å

PDB Description: Crystal structure of a protein of unknown function (DUF1244) from Alcanivorax borkumensis
PDB Compounds: (B:) Protein of unknown function (DUF1244)

SCOPe Domain Sequences for d3fybb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fybb1 a.293.1.0 (B:1-87) automated matches {Alcanivorax borkumensis [TaxId: 393595]}
madidqasktemeaaafrhllrhldehkdvqnidlmiqadfcrnclakwlmeaateqgve
ldydgareyvygmpfaewktlyqkpas

SCOPe Domain Coordinates for d3fybb1:

Click to download the PDB-style file with coordinates for d3fybb1.
(The format of our PDB-style files is described here.)

Timeline for d3fybb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3fybb2