![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.293: SMc04008-like [158756] (1 superfamily) multihelcal; intertwined homodimer; there are 4 core helices in each subunits; contains putative metal ion-binding motif MxxxxxCxxC in the conserved surface site |
![]() | Superfamily a.293.1: SMc04008-like [158757] (2 families) ![]() |
![]() | Family a.293.1.0: automated matches [227238] (1 protein) not a true family |
![]() | Protein automated matches [226996] (1 species) not a true protein |
![]() | Species Alcanivorax borkumensis [TaxId:393595] [225608] (1 PDB entry) |
![]() | Domain d3fybb1: 3fyb B:1-87 [210252] Other proteins in same PDB: d3fyba2, d3fybb2 automated match to d2o35a1 complexed with ca, cl, edo, peg |
PDB Entry: 3fyb (more details), 1.8 Å
SCOPe Domain Sequences for d3fybb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fybb1 a.293.1.0 (B:1-87) automated matches {Alcanivorax borkumensis [TaxId: 393595]} madidqasktemeaaafrhllrhldehkdvqnidlmiqadfcrnclakwlmeaateqgve ldydgareyvygmpfaewktlyqkpas
Timeline for d3fybb1: